PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013626588.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family MYB
Protein Properties Length: 330aa    MW: 37119.2 Da    PI: 4.6644
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013626588.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.84.3e-171461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g WT eEd++l+ +++++G g W+ I+++ g++R++k+c++rw +yl
   XP_013626588.1 14 KGVWTIEEDKKLISYIHEHGEGGWRDIPQKAGLKRCGKSCRLRWANYL 61
                     799*******************************************97 PP

2Myb_DNA-binding44.82.8e-1467111147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg ++ eE+++++ +++  G++ W+ Ia++++ +Rt++++k++w++ 
   XP_013626588.1  67 RGEFSYEEEQIIIMLHASRGNK-WSVIAKHLP-KRTDNEIKNYWNTN 111
                      899*******************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.606.6E-24564IPR009057Homeodomain-like
PROSITE profilePS5129423.777965IPR017930Myb domain
SuperFamilySSF466895.35E-2911108IPR009057Homeodomain-like
SMARTSM007172.6E-121363IPR001005SANT/Myb domain
PfamPF002493.7E-161461IPR001005SANT/Myb domain
CDDcd001675.90E-101761No hitNo description
Gene3DG3DSA:1.10.10.602.1E-2465116IPR009057Homeodomain-like
PROSITE profilePS5129418.08466116IPR017930Myb domain
SMARTSM007174.7E-1366114IPR001005SANT/Myb domain
PfamPF002492.1E-1367112IPR001005SANT/Myb domain
CDDcd001677.55E-1069112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 330 aa     Download sequence    Send to blast
MSRKPCCVRE GLKKGVWTIE EDKKLISYIH EHGEGGWRDI PQKAGLKRCG KSCRLRWANY  60
LKPDIKRGEF SYEEEQIIIM LHASRGNKWS VIAKHLPKRT DNEIKNYWNT NLKKRLIDQG  120
IDPLTHKPLG STPEPATPKT SDFQDDSNPS NLDEQSHSGS MSLKSLPLSS SSCNLLEISN  180
RDEVPRNYGT LNSKISSYTS ELLNKVAPRA ASMGNIISAS MEGTLIPSTT LSPPCLNDGL  240
SETSHFQMDE FDIDVNFDFN NSEHDFSQFM GEFSNNAAEE ADNIIGYDQD LLLSDVSSTN  300
VDEDGMMPNI TSWSNYLLDD SDFSYDTNQD
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1mse_C3e-25121162105C-Myb DNA-Binding Domain
1msf_C3e-25121162105C-Myb DNA-Binding Domain
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKM2627670.0KM262767.1 Brassica oleracea var. italica cultivar Fuqing 1 MYB29-1 transcription factor (myb29-1) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013626588.10.0PREDICTED: transcription factor MYB29-like
SwissprotQ9FLR11e-156MYB29_ARATH; Transcription factor MYB29
TrEMBLA0A0A0RAG30.0A0A0A0RAG3_BRAOT; MYB29-1 transcription factor (Fragment)
TrEMBLA0A0D3B0650.0A0A0D3B065_BRAOL; Uncharacterized protein
STRINGBra005949.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM37871860
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G07690.11e-154myb domain protein 29